PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000122904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Dof
Protein Properties Length: 306aa    MW: 32632.1 Da    PI: 8.4958
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000122904genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-383190261
         zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                   +++alkcprCds +tkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s
  MDP0000122904 31 NQQALKCPRCDSLHTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKXKRS 90
                   57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-263289IPR003851Zinc finger, Dof-type
PfamPF027018.0E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.183589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MQDIYSVRGG GRFFGGSGGG DRRLRPHQHP NQQALKCPRC DSLHTKFCYY NNYNLSQPRH  60
FCKACRRYWT KGGVLRNVPV GGGCRKXKRS KPKNSSSSSP TSSPPPPPPQ PNSADQNKSS  120
SHSSSESSSL TNPTAXAATA XTEAVSAPSS TGSASNLLTN IHNPESKFFV SQGGANGGFE  180
PGASAAALLE QITEINGLFS EIGSFTSLIT SSNDVPFSFG NINGSPFDQP AQVGNHHHNQ  240
VHQNQWGQQN QEGKMQEISG GLLDQTAQVD LSVFQNRSNG VGGGEFGPLD WQPGSVDQGC  300
LIFLTP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.123880.0fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572541e-54DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360883.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLD9ZIX71e-142D9ZIX7_MALDO; DOF domain class transcription factor
STRINGPOPTR_0015s03520.17e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-34OBF binding protein 4